| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase pim-1 |
|---|
| Ligand | BDBM50049395 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1509837 (CHEMBL3603720) |
|---|
| IC50 | 2710±n/a nM |
|---|
| Citation |  Chao, SW; Su, MY; Chiou, LC; Chen, LC; Chang, CI; Huang, WJ Total Synthesis of Hispidulin and the Structural Basis for Its Inhibition of Proto-oncogene Kinase Pim-1. J Nat Prod78:1969-76 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase pim-1 |
|---|
| Name: | Serine/threonine-protein kinase pim-1 |
|---|
| Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 35681.82 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P11309 |
|---|
| Residue: | 313 |
|---|
| Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
|---|
| BDBM50049395 |
|---|
| n/a |
|---|
| Name | BDBM50049395 |
|---|
| Synonyms: | 5,7,4'-Trihydroxy-6-methoxyflavone | 5,7-Dihydroxy-2-(4-hydroxy-phenyl)-6-methoxy-chromen-4-one | 5,7-dihydroxy-2-(4-hydroxyphenyl)-6-methoxy-4H-chromen-4-one | 6-methoxy apigenin | 6-methoxyapigenin | CHEMBL293776 | Hispidulin | NSC-122415 | TCMDC-123942 | cid_5281628 | dinatin |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H12O6 |
|---|
| Mol. Mass. | 300.2629 |
|---|
| SMILES | COc1c(O)cc2oc(cc(=O)c2c1O)-c1ccc(O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
