| Reaction Details |
|---|
 | Report a problem with these data |
| Target | RCG38204, isoform CRA_d |
|---|
| Ligand | BDBM14673 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1517183 (CHEMBL3620073) |
|---|
| Ki | 1562000±n/a nM |
|---|
| Citation |  Katane, M; Yamada, S; Kawaguchi, G; Chinen, M; Matsumura, M; Ando, T; Doi, I; Nakayama, K; Kaneko, Y; Matsuda, S; Saitoh, Y; Miyamoto, T; Sekine, M; Yamaotsu, N; Hirono, S; Homma, H Identification of Novel D-Aspartate Oxidase Inhibitors by in Silico Screening and Their Functional and Structural Characterization in Vitro. J Med Chem58:7328-40 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| RCG38204, isoform CRA_d |
|---|
| Name: | RCG38204, isoform CRA_d |
|---|
| Synonyms: | D-aspartate oxidase | Ddo | Ensembl:ENSRNOP00000000710 | LOC100911156 | Protein Ddo | RCG38204, isoform CRA_d | RGD:1595123 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 37549.70 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_109876 |
|---|
| Residue: | 341 |
|---|
| Sequence: | MDTVRIAVVGAGVIGLSTAACVSQLVPRCSVTVISDRFTPDTTSNVAAGMLIPPTYPDTP
VPTLKRWFRETFQHLSEIARSAEAVDAGIHLVSGWQIFRSVPTEEVPFWADVVLGFREMT
EAELKRFPQYEFGQAFTTLKCETSAYLPWLEKRIKGSGGLLLTRRIEDLWELQPSFDIVV
NCSGLGSRRLVGDATVSPVRGQVLQAQAPWVKHFIRDGGGLTYVYPGTSYVTLGGSRQTG
DWNLSPDAELSREIFSRCCALEPSLHRACDIKEKVGLRPSRPGVRLQKEILVRGEQRLPV
VHNYGHGSGGISVHWGSALEATRLVMECVHTLRTPASLSKL
|
|
|
|---|
| BDBM14673 |
|---|
| n/a |
|---|
| Name | BDBM14673 |
|---|
| Synonyms: | Fragment 3 | Malonic Acid | propanedioic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C3H4O4 |
|---|
| Mol. Mass. | 104.0615 |
|---|
| SMILES | OC(=O)CC(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
