Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase pim-3
LigandBDBM50131263
Substrate/Competitorn/a
Meas. Tech.ChEBML_1526830
Ki 0.160000±n/a nM
Citation Hu HWang XChan GKChang JHDo SDrummond JEbens ALee WLy JLyssikatos JPMurray JMoffat JGChao QTsui VWallweber HKolesnikov A Discovery of 3,5-substituted 6-azaindazoles as potent pan-Pim inhibitors. Bioorg Med Chem Lett 25:5258-64 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase pim-3
Name:Serine/threonine-protein kinase pim-3
Synonyms:Serine/threonine-protein kinase pim-3 (PIM3)
Type:Protein
Mol. Mass.:35888.19
Organism:Homo sapiens (Human)
Description:Q86V86
Residue:326
Sequence:
MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKAYQVGAVLGSGGFGTVYAGSRI
ADGLPVAVKHVVKERVTEWGSLGGATVPLEVVLLRKVGAAGGARGVIRLLDWFERPDGFL
LVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCHSCGVVHRDIKDENLLVDL
RSGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVC
GDIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGV
PESCDLRLCTLDPDDVASTTSSSESL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50131263
n/a
NameBDBM50131263
Synonyms:CHEMBL3634755 | US9260425, 264
TypeSmall organic molecule
Emp. Form.C20H21N7O
Mol. Mass.375.427
SMILESCn1cc(cn1)-c1cc2c(n[nH]c2cn1)-c1cccc(O[C@@H]2CCCNC2)n1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: