Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 1 |
---|
Ligand | BDBM50136540 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1548095 (CHEMBL3757927) |
---|
EC50 | 2.8±n/a nM |
---|
Citation | Horan, JC; Kuzmich, D; Liu, P; DiSalvo, D; Lord, J; Mao, C; Hopkins, TD; Yu, H; Harcken, C; Betageri, R; Hill-Drzewi, M; Patenaude, L; Patel, M; Fletcher, K; Terenzzio, D; Linehan, B; Xia, H; Patel, M; Studwell, D; Miller, C; Hickey, E; Levin, JI; Smith, D; Kemper, RA; Modis, LK; Bannen, LC; Chan, DS; Mac, MB; Ng, S; Wang, Y; Xu, W; Lemieux, RM Late-stage optimization of a tercyclic class of S1P3-sparing, S1P1 receptor agonists. Bioorg Med Chem Lett26:466-71 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 1 |
---|
Name: | Sphingosine 1-phosphate receptor 1 |
Synonyms: | CHEDG1 | EDG1 | Endothelial differentiation G-protein coupled receptor 1 | S1P receptor | S1P1 | S1PR1 | S1PR1_HUMAN | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1 |
Type: | Enzyme |
Mol. Mass.: | 42836.02 |
Organism: | Homo sapiens (Human) |
Description: | P21453 |
Residue: | 382 |
Sequence: | MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
|
|
|
BDBM50136540 |
---|
n/a |
---|
Name | BDBM50136540 |
Synonyms: | CHEMBL3753059 |
Type | Small organic molecule |
Emp. Form. | C21H23N5O4 |
Mol. Mass. | 409.4384 |
SMILES | CC(C)Nc1cc(cc(C)n1)-c1nc(no1)-c1ccc(OC[C@H]2COC(=O)N2)cc1 |r| |
Structure |
|