| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein S100-B |
|---|
| Ligand | BDBM50146592 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1555503 (CHEMBL3768085) |
|---|
| IC50 | 18300±n/a nM |
|---|
| Citation |  Cavalier, MC; Ansari, MI; Pierce, AD; Wilder, PT; McKnight, LE; Raman, EP; Neau, DB; Bezawada, P; Alasady, MJ; Charpentier, TH; Varney, KM; Toth, EA; MacKerell, AD; Coop, A; Weber, DJ Small Molecule Inhibitors of Ca(2+)-S100B Reveal Two Protein Conformations. J Med Chem59:592-608 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein S100-B |
|---|
| Name: | Protein S100-B |
|---|
| Synonyms: | Protein S100-B | S-100 protein beta chain | S-100 protein subunit beta | S100 calcium-binding protein B | S100B_RAT | S100b |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 10731.34 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_116732 |
|---|
| Residue: | 92 |
|---|
| Sequence: | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET
LDEDGDGECDFQEFMAFVSMVTTACHEFFEHE
|
|
|
|---|
| BDBM50146592 |
|---|
| n/a |
|---|
| Name | BDBM50146592 |
|---|
| Synonyms: | CHEMBL3764285 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C36H60N6O2 |
|---|
| Mol. Mass. | 608.9006 |
|---|
| SMILES | NCCCCCCCNC(=N)c1ccc(OCCCCCCCCOc2ccc(cc2)C(=N)NCCCCCCCN)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
