Reaction Details |
| Report a problem with these data |
Target | dCTP pyrophosphatase 1 |
---|
Ligand | BDBM50150052 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_1558383 |
---|
IC50 | 47±n/a nM |
---|
Citation | Llona-Minguez, S; Höglund, A; Jacques, SA; Johansson, L; Calderón-Montaño, JM; Claesson, M; Loseva, O; Valerie, NC; Lundbäck, T; Piedrafita, J; Maga, G; Crespan, E; Meijer, L; Burgos Morón, E; Baranczewski, P; Hagbjörk, AL; Svensson, R; Wiita, E; Almlöf, I; Visnes, T; Jeppsson, F; Sigmundsson, K; Jensen, AJ; Artursson, P; Jemth, AS; Stenmark, P; Warpman Berglund, U; Scobie, M; Helleday, T Discovery of the First Potent and Selective Inhibitors of Human dCTP Pyrophosphatase 1. J Med Chem59:1140-8 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
dCTP pyrophosphatase 1 |
---|
Name: | dCTP pyrophosphatase 1 |
Synonyms: | DCTP1_HUMAN | DCTPP1 | Deoxycytidine-triphosphatase 1 | XTP3TPA | dCTP pyrophosphatase 1 | dCTP pyrophosphatase 1 (DCTPP1) |
Type: | Protein |
Mol. Mass.: | 18673.58 |
Organism: | Homo sapiens (Human) |
Description: | Q9H773 |
Residue: | 170 |
Sequence: | MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLAL
VGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLS
KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST
|
|
|
BDBM50150052 |
---|
n/a |
---|
Name | BDBM50150052 |
Synonyms: | CHEMBL3771105 |
Type | Small organic molecule |
Emp. Form. | C20H17BCl2N4O6 |
Mol. Mass. | 491.089 |
SMILES | CN1CC(=O)OB(OC(=O)C1)c1ccc(Cn2c(C)nc3c(c(Cl)c(Cl)cc23)[N+]([O-])=O)cc1 |
Structure |
|