| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Arachidonate 5-lipoxygenase-activating protein |
|---|
| Ligand | BDBM50000541 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1563594 (CHEMBL3783530) |
|---|
| IC50 | 580±n/a nM |
|---|
| Citation |  Banoglu, E; Çelikoglu, E; Völker, S; Olgaç, A; Gerstmeier, J; Garscha, U; Çaliskan, B; Schubert, US; Carotti, A; Macchiarulo, A; Werz, O 4,5-Diarylisoxazol-3-carboxylic acids: A new class of leukotriene biosynthesis inhibitors potentially targeting 5-lipoxygenase-activating protein (FLAP). Eur J Med Chem113:1-10 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Arachidonate 5-lipoxygenase-activating protein |
|---|
| Name: | Arachidonate 5-lipoxygenase-activating protein |
|---|
| Synonyms: | 5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | 5-lipoxygenase/FLAP | AL5AP_HUMAN | ALOX5AP | FLAP | MK-886-binding protein |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18159.90 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P20292 |
|---|
| Residue: | 161 |
|---|
| Sequence: | MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
|
|
|
|---|
| BDBM50000541 |
|---|
| n/a |
|---|
| Name | BDBM50000541 |
|---|
| Synonyms: | (+-)-1-(1-Benzo[b]thien-2-ylethyl)-1-hydroxyurea | 1-[1-(1-benzothien-2-yl)ethyl]-1-hydroxyurea | CHEMBL93 | Leutrol | N-(1-Benzo(b)thien-2-ylethyl)-N-hydroxyurea | N-[1-(benzo[b]thiophen-2-yl)ethyl]-N-hydroxyurea | ZILEUTON | Zyflo (TN) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H12N2O2S |
|---|
| Mol. Mass. | 236.29 |
|---|
| SMILES | CC(N(O)C(N)=O)c1cc2ccccc2s1 |
|---|
| Structure | 
|
|---|
Search and Browse
