Reaction Details |
| Report a problem with these data |
Target | Chromobox protein homolog 7 |
---|
Ligand | BDBM50009463 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1565742 (CHEMBL3782540) |
---|
IC50 | 73000±n/a nM |
---|
Citation | Milosevich, N; Gignac, MC; McFarlane, J; Simhadri, C; Horvath, S; Daze, KD; Croft, CS; Dheri, A; Quon, TT; Douglas, SF; Wulff, JE; Paci, I; Hof, F Selective Inhibition of CBX6: A Methyllysine Reader Protein in the Polycomb Family. ACS Med Chem Lett7:139-44 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chromobox protein homolog 7 |
---|
Name: | Chromobox protein homolog 7 |
Synonyms: | CBX7 | CBX7_HUMAN | Chromobox protein homolog 7 | Chromobox protein homolog 7 (CBX7) |
Type: | Protein |
Mol. Mass.: | 28351.76 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 251 |
Sequence: | MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKA
GAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAP
DVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAA
EGFFRDRSGKF
|
|
|
BDBM50009463 |
---|
n/a |
---|
Name | BDBM50009463 |
Synonyms: | CHEMBL3234145 |
Type | Small organic molecule |
Emp. Form. | C35H52N7O8 |
Mol. Mass. | 698.8289 |
SMILES | C[C@H](NC(=O)[C@H](Cc1ccccc1)NC(C)=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCC[N+](C)(C)C)C(=O)N[C@@H](CO)C(N)=O |r| |
Structure |
|