| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Ligand | BDBM50162683 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1570258 (CHEMBL3795200) |
|---|
| Ki | 23400±n/a nM |
|---|
| Citation |  Gaali, S; Feng, X; Hähle, A; Sippel, C; Bracher, A; Hausch, F Rapid, Structure-Based Exploration of Pipecolic Acid Amides as Novel Selective Antagonists of the FK506-Binding Protein 51. J Med Chem59:2410-22 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
|---|
| Synonyms: | 12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKB1A_HUMAN | FKBP-12 | FKBP-1A | FKBP1 | FKBP12 | FKBP1A | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase | RyR1/FKBP12 | mTOR/FKBP12A/FKBP12B |
|---|
| Type: | Isomerase |
|---|
| Mol. Mass.: | 11953.09 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P62942 |
|---|
| Residue: | 108 |
|---|
| Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
|
|
|
|---|
| BDBM50162683 |
|---|
| n/a |
|---|
| Name | BDBM50162683 |
|---|
| Synonyms: | CHEMBL3792567 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H41N3O6 |
|---|
| Mol. Mass. | 515.6416 |
|---|
| SMILES | COc1cc(cc(OC)c1OC)[C@H](C1CCCCC1)C(=O)N1CCCC[C@H]1C(=O)NC1(CCC1)C(N)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
