Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRhodopsin kinase
LigandBDBM50173310
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1581284
IC50 3900±n/a nM
Citation Waldschmidt HVHoman KTCruz-Rodríguez OCato MCWaninger-Saroni JLarimore KMCannavo ASong JCheung JYKirchhoff PDKoch WJTesmer JJLarsen SD Structure-Based Design, Synthesis, and Biological Evaluation of Highly Selective and Potent G Protein-Coupled Receptor Kinase 2 Inhibitors. J Med Chem 59:3793-807 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Rhodopsin kinase
Name:Rhodopsin kinase
Synonyms:G protein-coupled receptor kinase 1 | GRK1 | PK | RHOK
Type:PROTEIN
Mol. Mass.:63520.09
Organism:Homo sapiens (Human)
Description:ChEMBL_774378
Residue:563
Sequence:
MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFES
VCLEQPIGKKLFQQFLQSAEKHLPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAK
LFCSFLDEGIVAKFKEGPVEIQDGLFQPLLQATLAHLGQAPFQEYLGSLYFLRFLQWKWL
EAQPMGEDWFLDFRVLGKGGFGEVSACQMKATGKLYACKKLNKKRLKKRKGYQGAMVEKK
ILMKVHSRFIVSLAYAFETKADLCLVMTIMNGGDIRYHIYNVNEENPGFPEPRALFYTAQ
IICGLEHLHQRRIVYRDLKPENVLLDNDGNVRISDLGLAVELLDGQSKTKGYAGTPGFMA
PELLQGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKHRIISEPVKYPDKFS
QASKDFCEALLEKDPEKRLGFRDETCDKLRAHPLFKDLNWRQLEAGMLMPPFIPDSKTVY
AKDIQDVGAFSTVKGVAFDKTDTEFFQEFATGNCPIPWQEEMIETGIFGELNVWRSDGQM
PDDMKGISGGSSSSSKSGMCLVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50173310
n/a
NameBDBM50173310
Synonyms:CHEMBL3808660 | US10023564, Example 1
TypeSmall organic molecule
Emp. Form.C26H22FN7O3
Mol. Mass.499.4964
SMILESCC1=C(C(NC(=O)N1)c1ccc(F)c(c1)C(=O)NCc1ccccn1)C(=O)Nc1ccc2[nH]ncc2c1 |t:1|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: