Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetActivin receptor type-1
LigandBDBM50183448
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1586817
IC50 5130±n/a nM
Citation Martin LJKoegl MBader GCockcroft XLFedorov OFiegen DGerstberger THofmann MHHohmann AFKessler DKnapp SKnesl PKornigg SMüller SNar HRogers CRumpel KSchaaf OSteurer STallant CVakoc CRZeeb MZoephel APearson MBoehmelt GMcConnell D Structure-Based Design of an in Vivo Active Selective BRD9 Inhibitor. J Med Chem 59:4462-75 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Activin receptor type-1
Name:Activin receptor type-1
Synonyms:2.7.11.30 | ACTR-I | ACVR1 | ACVRLK2 | ALK-2 | ALK2/ACVR1 | Activin receptor type I | Activin receptor-like kinase 2 | Activin receptor-like kinase 2 (ALK-2) | Activin receptor-like kinase 2 (ALK2/ACVR1) | Q04771 | SKR1 | Serine/threonine-protein kinase receptor R1 | TGF-B superfamily receptor type I | TSR-I
Type:n/a
Mol. Mass.:57158.32
Organism:Homo sapiens (Human)
Description:n/a
Residue:509
Sequence:
MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSIN
DGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF
HLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTL
ADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSR
DEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTL
DTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVM
HSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVS
NGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQ
NPSARLTALRIKKTLTKIDNSLDKLKTDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50183448
n/a
NameBDBM50183448
Synonyms:CHEMBL3823478
TypeSmall organic molecule
Emp. Form.C20H23N3O3
Mol. Mass.353.4149
SMILESCOc1cc(cc(OC)c1CN(C)C)-c1cn(C)c(=O)c2cnccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: