Reaction Details |
| Report a problem with these data |
Target | Chromobox protein homolog 7 |
---|
Ligand | BDBM50189711 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1590117 (CHEMBL3829385) |
---|
Ki | 25000±n/a nM |
---|
Citation | Ren, C; Smith, SG; Yap, K; Li, S; Li, J; Mezei, M; Rodriguez, Y; Vincek, A; Aguilo, F; Walsh, MJ; Zhou, MM Structure-Guided Discovery of Selective Antagonists for the Chromodomain of Polycomb Repressive Protein CBX7. ACS Med Chem Lett7:601-5 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chromobox protein homolog 7 |
---|
Name: | Chromobox protein homolog 7 |
Synonyms: | CBX7 | CBX7_HUMAN | Chromobox protein homolog 7 | Chromobox protein homolog 7 (CBX7) |
Type: | Protein |
Mol. Mass.: | 28351.76 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 251 |
Sequence: | MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKA
GAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAP
DVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAA
EGFFRDRSGKF
|
|
|
BDBM50189711 |
---|
n/a |
---|
Name | BDBM50189711 |
Synonyms: | CHEMBL3827805 |
Type | Small organic molecule |
Emp. Form. | C24H31N3O7S |
Mol. Mass. | 505.584 |
SMILES | CCS(=O)(=O)Nc1ccc(OCC(=O)N2CCN(CC2)C(=O)c2cccc(OC)c2OC)cc1C |
Structure |
|