Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRhodopsin kinase
LigandBDBM3149
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1612806
IC50 4100±n/a nM
Citation Guccione MEttari RTaliani SDa Settimo FZappalą MGrasso S G-Protein-Coupled Receptor Kinase 2 (GRK2) Inhibitors: Current Trends and Future Perspectives. J Med Chem 59:9277-9294 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Rhodopsin kinase
Name:Rhodopsin kinase
Synonyms:G protein-coupled receptor kinase 1 | GRK1 | RHOK | Rhodopsin kinase
Type:PROTEIN
Mol. Mass.:62931.24
Organism:Bos taurus
Description:ChEMBL_116985
Residue:561
Sequence:
MDFGSLETVVANSAFIAARGSFDASSGPASRDRKYLARLKLPPLSKCEALRESLDLGFEG
MCLEQPIGKRLFQQFLRTHEQHGPALQLWKDIEDYDTADDALRPQKAQALRAAYLEPQAQ
LFCSFLDAETVARARAGAGDGLFQPLLRAVLAHLGQAPFQEFLDSLYFLRFLQWKWLEAQ
PMGEDWFLDFRVLGRGGFGEVFACQMKATGKLYACKKLNKKRLKKRKGYQGAMVEKKILA
KVHSRFIVSLAYAFETKTDLCLVMTIMNGGDIRYHIYNVDEDNPGFQEPRAIFYTAQIVS
GLEHLHQRNIIYRDLKPENVLLDDDGNVRISDLGLAVELKAGQTKTKGYAGTPGFMAPEL
LLGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKQRVLEQAVTYPDKFSPAS
KDFCEALLQKDPEKRLGFRDGSCDGLRTHPLFRDISWRQLEAGMLTPPFVPDSRTVYAKN
IQDVGAFSTVKGVAFEKADTEFFQEFASGTCPIPWQEEMIETGVFGDLNVWRPDGQMPDD
MKGVSGQEAAPSSKSGMCVLS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM3149
n/a
NameBDBM3149
Synonyms:2-{[2,6-dihydroxy-4-({[(3R,4R)-3-[(4-hydroxybenzene)amido]azepan-4-yl]oxy}carbonyl)phenyl]carbonyl}-3-hydroxybenzoic acid | Acyclic Balanol Analog (-)-1 | Balanol analog 1 | Balanol, 1 | CHEMBL60254
TypeSmall organic molecule
Emp. Form.C28H26N2O10
Mol. Mass.550.5134
SMILESOC(=O)c1cccc(O)c1C(=O)c1c(O)cc(cc1O)C(=O)O[C@@H]1CCCNC[C@H]1NC(=O)c1ccc(O)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: