Reaction Details |
| Report a problem with these data |
Target | Arachidonate 5-lipoxygenase-activating protein |
---|
Ligand | BDBM50202473 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1624271 (CHEMBL3866683) |
---|
IC50 | 12±n/a nM |
---|
Citation | Levent, S; Gerstmeier, J; Olgaç, A; Nikels, F; Garscha, U; Carotti, A; Macchiarulo, A; Werz, O; Banoglu, E; Çaliskan, B Synthesis and biological evaluation of C(5)-substituted derivatives of leukotriene biosynthesis inhibitor BRP-7. Eur J Med Chem122:510-519 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Arachidonate 5-lipoxygenase-activating protein |
---|
Name: | Arachidonate 5-lipoxygenase-activating protein |
Synonyms: | 5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | 5-lipoxygenase/FLAP | AL5AP_HUMAN | ALOX5AP | FLAP | MK-886-binding protein |
Type: | Enzyme |
Mol. Mass.: | 18159.90 |
Organism: | Homo sapiens (Human) |
Description: | P20292 |
Residue: | 161 |
Sequence: | MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
|
|
|
BDBM50202473 |
---|
n/a |
---|
Name | BDBM50202473 |
Synonyms: | CHEMBL3954390 |
Type | Small organic molecule |
Emp. Form. | C27H26ClN3 |
Mol. Mass. | 427.968 |
SMILES | CC(C)Cc1ccc(cc1)C(C)c1nc2cc(ccc2n1Cc1ccccc1Cl)C#N |
Structure |
|