Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E synthase |
---|
Ligand | BDBM50207322 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1630873 (CHEMBL3873579) |
---|
IC50 | 277±n/a nM |
---|
Citation | Muthukaman, N; Deshmukh, S; Sarode, N; Tondlekar, S; Tambe, M; Pisal, D; Shaikh, M; Kattige, VG; Honnegowda, S; Karande, V; Kulkarni, A; Jadhav, SB; Mahat, MYA; Gudi, GS; Khairatkar-Joshi, N; Gharat, LA Discovery of 2-((2-chloro-6-fluorophenyl)amino)-N-(3-fluoro-5-(trifluoromethyl)phenyl)-1-methyl-7,8-dihydro-1H-[1,4]dioxino[2',3':3,4]benzo[1,2-d]imidazole-5-carboxamide as potent, selective and efficacious microsomal prostaglandin E Bioorg Med Chem Lett26:5977-5984 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E synthase |
---|
Name: | Prostaglandin E synthase |
Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
Type: | Protein |
Mol. Mass.: | 17112.22 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 152 |
Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
BDBM50207322 |
---|
n/a |
---|
Name | BDBM50207322 |
Synonyms: | CHEMBL3916119 |
Type | Small organic molecule |
Emp. Form. | C27H19ClF2N4O3 |
Mol. Mass. | 520.915 |
SMILES | Fc1cccc(Cl)c1Nc1nc2cc(C(=O)Nc3ccc(C#CC4CC4)c(F)c3)c3OCCOc3c2[nH]1 |
Structure |
|