Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase kinase kinase 7
LigandBDBM50209651
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1633899
Ki 160±n/a nM
Citation Tan LGurbani DWeisberg ELHunter JCLi LJones DSFicarro SBMowafy STam CPRao SDu GGriffin JDSorger PKMarto JAWestover KDGray NS Structure-guided development of covalent TAK1 inhibitors. Bioorg Med Chem 25:838-846 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase kinase kinase 7
Name:Mitogen-activated protein kinase kinase kinase 7
Synonyms:MAP3K7 | TAK1 | TGF-beta-activated kinase 1 | Transforming growth factor-beta-activated kinase 1 (TAK1)
Type:Protein
Mol. Mass.:67199.89
Organism:Homo sapiens (Human)
Description:O43318
Residue:606
Sequence:
MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGN
ILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHP
WTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEI
ALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQ
KRQGTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50209651
n/a
NameBDBM50209651
Synonyms:CHEMBL3883384
TypeSmall organic molecule
Emp. Form.C24H26ClN7O
Mol. Mass.463.963
SMILESCN1CCN(CC1)c1ccc(Nc2ncc(Cl)c(Nc3ccccc3NC(=O)C=C)n2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: