| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 5A |
|---|
| Ligand | BDBM10755 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1651925 |
|---|
| Ki | 130±n/a nM |
|---|
| Citation |  Odell, LR; Abdel-Hamid, MK; Hill, TA; Chau, N; Young, KA; Deane, FM; Sakoff, JA; Andersson, S; Daniel, JA; Robinson, PJ; McCluskey, A Pyrimidine-Based Inhibitors of Dynamin I GTPase Activity: Competitive Inhibition at the Pleckstrin Homology Domain. J Med Chem60:349-361 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 5A |
|---|
| Name: | 5-hydroxytryptamine receptor 5A |
|---|
| Synonyms: | 5-HT-5 | 5-HT-5A | 5-hydroxytryptamine receptor 5 (5-HT5) | 5-hydroxytryptamine receptor 5A (5-HT5A) | 5HT5A_HUMAN | HTR5A | Serotonin (5-HT) receptor | Serotonin receptor 5A |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40266.25 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P47898 |
|---|
| Residue: | 357 |
|---|
| Sequence: | MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL
VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG
WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS
PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP
FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
|
|
|
|---|
| BDBM10755 |
|---|
| n/a |
|---|
| Name | BDBM10755 |
|---|
| Synonyms: | 14C-5-hydroxy tryptamine creatinine disulfate | 2-imino-1-methylimidazolidin-4-one; 3-(2-aminoethyl)-1H-indol-5-ol; bis(sulfuric acid) | 5-HT | 5-Hydroxy Tryptamine | 5-hydroxy tryptamine creatinine disulfate | CHEMBL535832 | Serotonin | [3H]-5-HT |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H12N2O |
|---|
| Mol. Mass. | 176.2151 |
|---|
| SMILES | NCCc1c[nH]c2ccc(O)cc12 |
|---|
| Structure | 
|
|---|
Search and Browse
