Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2a
LigandBDBM50235055
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1654441
Ki 0.200000±n/a nM
Citation Basu SBarawkar DAThorat SShejul YDPatel MNaykodi MJain VSalve YPrasad VChaudhary SGhosh IBhat GQuraishi APatil HAnsari SMenon SUnadkat VThakare RSeervi MSMeru AVDe SBhamidipati RKRouduri SRPalle VPChug AMookhtiar KA Design, Synthesis of Novel, Potent, Selective, Orally Bioavailable Adenosine A J Med Chem 60:681-694 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2a
Name:Adenosine receptors; A2a & A2b
Synonyms:A2A adenosine receptor (hA2A) | ADENOSINE A2 | ADENOSINE A2a | ADORA2 | ADORA2A | Adenosine A2A receptor (A2AAR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44716.46
Organism:Homo sapiens (Human)
Description:P29274
Residue:412
Sequence:
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50235055
n/a
NameBDBM50235055
Synonyms:CHEMBL4095355
TypeSmall organic molecule
Emp. Form.C24H36N4O3S
Mol. Mass.460.633
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: