Reaction Details |
| Report a problem with these data |
Target | ATP-sensitive inward rectifier potassium channel 1 |
---|
Ligand | BDBM50235195 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1654962 (CHEMBL4004328) |
---|
IC50 | 240±n/a nM |
---|
Citation | Chobanian, HR; Guo, Y; Pio, B; Tang, H; Teumelsan, N; Clements, M; Frie, J; Ferguson, R; Guo, Z; Thomas-Fowlkes, BS; Felix, JP; Liu, J; Kohler, M; Priest, B; Hampton, C; Pai, LY; Corona, A; Metzger, J; Tong, V; Joshi, EM; Xu, L; Owens, K; Maloney, K; Sullivan, K; Pasternak, A The design and synthesis of novel spirocyclic heterocyclic sulfone ROMK inhibitors as diuretics. Bioorg Med Chem Lett27:1109-1114 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
ATP-sensitive inward rectifier potassium channel 1 |
---|
Name: | ATP-sensitive inward rectifier potassium channel 1 |
Synonyms: | ATP-regulated potassium channel ROM-K | ATP-sensitive inward rectifier potassium channel 1 | Inward rectifier K(+) channel Kir1.1 | KAB-1 | KCNJ1_RAT | Kcnj1 | Potassium channel (ATP modulatory) | Potassium channel, inwardly rectifying subfamily J member 1 | Renal Outer Medullary Potassium (ROMK) | Renal Outer Medullary Potassium (ROMK1) | Romk1 | The Renal Outer Medullary Potassium (ROMK) channel (Kir1.1) |
Type: | Enzyme |
Mol. Mass.: | 44976.27 |
Organism: | Rattus norvegicus (Rat) |
Description: | P35560 |
Residue: | 391 |
Sequence: | MGASERSVFRVLIRALTERMFKHLRRWFITHIFGRSRQRARLVSKEGRCNIEFGNVDAQS
RFIFFVDIWTTVLDLKWRYKMTVFITAFLGSWFLFGLLWYVVAYVHKDLPEFYPPDNRTP
CVENINGMTSAFLFSLETQVTIGYGFRFVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTITPEGE
TIILDQTNINFVVDAGNENLFFISPLTIYHIIDHNSPFFHMAAETLSQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFVPIVSKTKEGKYRVDFHNFGKTVEVETPHCAMCLY
NEKDARARMKRGYDNPNFVLSEVDETDDTQM
|
|
|
BDBM50235195 |
---|
n/a |
---|
Name | BDBM50235195 |
Synonyms: | CHEMBL4087218 |
Type | Small organic molecule |
Emp. Form. | C25H31N3O5S |
Mol. Mass. | 485.596 |
SMILES | Cc1c2COC(=O)c2ccc1[C@@H](O)CN1CCC2(CCN(C2)c2ccc(nc2)S(C)(=O)=O)CC1 |r| |
Structure |
|