Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlkaline phosphatase, tissue-nonspecific isozyme
LigandBDBM50237916
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1662569
IC50 1830±n/a nM
Citation Salar UKhan KMIqbal JEjaz SAHameed AAl-Rashida MPerveen STahir MN Coumarin sulfonates: New alkaline phosphatase inhibitors; in vitro and in silico studies. Eur J Med Chem 131:29-47 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alkaline phosphatase, tissue-nonspecific isozyme
Name:Alkaline phosphatase, tissue-nonspecific isozyme
Synonyms:tissue-nonspecific alkaline phosphatase precursor
Type:PROTEIN
Mol. Mass.:57306.17
Organism:Homo sapiens (Human)
Description:ChEMBL_1448917
Residue:524
Sequence:
MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGD
GMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCG
VKANEGTVGVSAATERSRCNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAH
SADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVIMGGGRKYMYPKNKTDVEYESDE
KARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLTLDPHNVDYLLGLFEPGDMQYELN
RNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIG
QAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPG
YKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYV
PHVMAYAACIGANLGHCAPASSAGSLAAGPLLLALALYPLSVLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50237916
n/a
NameBDBM50237916
Synonyms:CHEMBL4094534
TypeSmall organic molecule
Emp. Form.C16H9Cl3O5S
Mol. Mass.419.664
SMILESCc1c(Cl)c(=O)oc2cc(OS(=O)(=O)c3cc(Cl)ccc3Cl)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: