Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKynurenine 3-monooxygenase
LigandBDBM50237997
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1662711
IC50 100±n/a nM
Citation Liddle JBeaufils BBinnie MBouillot ADenis AAHann MMHaslam CPHolmes DSHutchinson JPKranz MMcBride AMirguet OMole DJMowat CGPal SRowland PTrottet LUings IJWalker ALWebster SP The discovery of potent and selective kynurenine 3-monooxygenase inhibitors for the treatment of acute pancreatitis. Bioorg Med Chem Lett 27:2023-2028 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kynurenine 3-monooxygenase
Name:Kynurenine 3-monooxygenase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:55831.03
Organism:Homo sapiens (Human)
Description:ChEMBL_1487479
Residue:486
Sequence:
MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDTRVATFTRGRSINLALSH
RGRQALKAVGLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLT
AAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKK
PRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMP
FEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCV
LLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLS
MYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKK
VINKGLFFLGSLIAISSTYLLIHYMSPRSFLRLRRPWNWIAHFRNTTCFPAKAVDSLEQI
SNLISR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50237997
n/a
NameBDBM50237997
Synonyms:CHEMBL4069680
TypeSmall organic molecule
Emp. Form.C11H7ClN2O4
Mol. Mass.266.637
SMILESOC(=O)CCn1c2cc(Cl)c(cc2oc1=O)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: