| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 2A |
|---|
| Ligand | BDBM50238481 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1663652 (CHEMBL4013333) |
|---|
| EC50 | >10000±n/a nM |
|---|
| Citation |  Carpenter, J; Carpenter, J; Wang, Y; Wang, Y; Wu, G; Wu, G; Feng, J; Feng, J; Ye, XY; Ye, XY; Morales, CL; Morales, CL; Broekema, M; Broekema, M; Rossi, KA; Rossi, KA; Miller, KJ; Miller, KJ; Murphy, BJ; Murphy, BJ; Wu, G; Wu, G; Malmstrom, SE; Malmstrom, SE; Azzara, AV; Azzara, AV; Sher, PM; Sher, PM; Fevig, JM; Fevig, JM; Alt, A; Alt, A; Bertekap, RL; Bertekap, RL; Cullen, MJ; Cullen, MJ; Harper, TM; Harper, TM; Foster, K; Foster, K; Luk, E; Luk, E; Xiang, Q; Xiang, Q; Grubb, MF; Grubb, MF; Robl, JA; Robl, JA; Wacker, DA; Wacker, DA Utilization of an Active Site Mutant Receptor for the Identification of Potent and Selective Atypical 5-HT J Med Chem60:6166-6190 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 2A |
|---|
| Name: | 5-hydroxytryptamine receptor 2A |
|---|
| Synonyms: | 5-HT-2 | 5-HT-2A | 5-HT2A | 5-hydroxytryptamine receptor 2A (5-HT-2A) | 5-hydroxytryptamine receptor 2A (5HT-2A) | 5-hydroxytryptamine receptor 2A (5HT2A) | 5HT2A_HUMAN | HTR2 | HTR2A | Serotonin receptor 2A |
|---|
| Type: | undefined |
|---|
| Mol. Mass.: | 52607.65 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P28223 |
|---|
| Residue: | 471 |
|---|
| Sequence: | MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
|
|
|
|---|
| BDBM50238481 |
|---|
| n/a |
|---|
| Name | BDBM50238481 |
|---|
| Synonyms: | CHEMBL4072337 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H24N2O2 |
|---|
| Mol. Mass. | 348.4382 |
|---|
| SMILES | Cn1cc(cc1C(=O)N1CCC(CO)CC1)-c1cccc2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
