| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gamma-aminobutyric acid receptor subunit alpha-1 |
|---|
| Ligand | BDBM22913 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | >10000±n/a nM |
|---|
| Comments | PDSP_2292 |
|---|
| Citation |  Leurs, R; Tulp, MT; Menge, WM; Adolfs, MJ; Zuiderveld, OP; Timmerman, H Evaluation of the receptor selectivity of the H3 receptor antagonists, iodophenpropit and thioperamide: an interaction with the 5-HT3 receptor revealed. Br J Pharmacol116:2315-21 (1995) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Gamma-aminobutyric acid receptor subunit alpha-1 |
|---|
| Name: | Gamma-aminobutyric acid receptor subunit alpha-1 |
|---|
| Synonyms: | Benzodiazepine central | Benzodiazepine receptors | GABA A Benzodiazepine | GABA A Benzodiazepine Type I | GABA A Benzodiazepine Type II | GABA A Benzodiazepine Type IIL | GABA A Benzodiazepine Type IIM | GABA A Benzodiazepine omega1 | GABA A Benzodiazepine omega2 | GABA A Benzodiazepine omega5 | GABA A alpha1 | GABA A anti-Alpha1 | GABA receptor alpha-1 subunit | GABA, Chloride, TBOB | GABA-PICROTOXIN | GBRA1_RAT | Gabra-1 | Gabra1 | TBPS |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 51770.21 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | P62813 |
|---|
| Residue: | 455 |
|---|
| Sequence: | MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGL
GERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKI
WTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACP
LKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMT
THFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISAR
NSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPL
IKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDR
LSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
|
|
|
|---|
| BDBM22913 |
|---|
| n/a |
|---|
| Name | BDBM22913 |
|---|
| Synonyms: | CHEMBL1237146 | CHEMBL498770 | Iodophenpropit | {[3-(1H-imidazol-5-yl)propyl]sulfanyl}-N''-[2-(4-iodophenyl)ethyl]methanimidamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H19IN4S |
|---|
| Mol. Mass. | 414.308 |
|---|
| SMILES | NC(SCCCc1cnc[nH]1)=NCCc1ccc(I)cc1 |w:11.12| |
|---|
| Structure | 
|
|---|
Search and Browse
