| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Somatostatin receptor type 2 |
|---|
| Ligand | BDBM81766 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 0.05±n/a nM |
|---|
| Comments | PDSP_1242 |
|---|
| Citation |  Yang, L; Berk, SC; Rohrer, SP; Mosley, RT; Guo, L; Underwood, DJ; Arison, BH; Birzin, ET; Hayes, EC; Mitra, SW; Parmar, RM; Cheng, K; Wu, TJ; Butler, BS; Foor, F; Pasternak, A; Pan, Y; Silva, M; Freidinger, RM; Smith, RG; Chapman, K; Schaeffer, JM; Patchett, AA Synthesis and biological activities of potent peptidomimetics selective for somatostatin receptor subtype 2. Proc Natl Acad Sci U S A95:10836-41 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Somatostatin receptor type 2 |
|---|
| Name: | Somatostatin receptor type 2 |
|---|
| Synonyms: | SOMATOSTATIN SST2 | SRIF-1 | SS-2-R | SS2-R | SS2R | SSR2_HUMAN | SSTR2 | Somatostatin receptor type 2 (SSTR2) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 41344.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30874 |
|---|
| Residue: | 369 |
|---|
| Sequence: | MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIY
AGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI
|
|
|
|---|
| BDBM81766 |
|---|
| n/a |
|---|
| Name | BDBM81766 |
|---|
| Synonyms: | CAS_3086456 | MK 678 | NSC_3086456 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C44H56N8O7 |
|---|
| Mol. Mass. | 808.9648 |
|---|
| SMILES | CC(C)C1NC(=O)C(CCCCN)NC(=O)C(Cc2c[nH]c3ccccc23)NC(=O)C(Cc2ccc(O)cc2)NC(=O)C(C)N(C)C(=O)C(Cc2ccccc2)NC1=O |
|---|
| Structure | 
|
|---|
Search and Browse
