Reaction Details |
| Report a problem with these data |
Target | Somatostatin receptor type 4 |
---|
Ligand | BDBM81766 |
---|
Substrate/Competitor | n/a |
---|
Ki | 4949±n/a nM |
---|
Comments | PDSP_1242 |
---|
Citation | Yang, L; Berk, SC; Rohrer, SP; Mosley, RT; Guo, L; Underwood, DJ; Arison, BH; Birzin, ET; Hayes, EC; Mitra, SW; Parmar, RM; Cheng, K; Wu, TJ; Butler, BS; Foor, F; Pasternak, A; Pan, Y; Silva, M; Freidinger, RM; Smith, RG; Chapman, K; Schaeffer, JM; Patchett, AA Synthesis and biological activities of potent peptidomimetics selective for somatostatin receptor subtype 2. Proc Natl Acad Sci U S A95:10836-41 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Somatostatin receptor type 4 |
---|
Name: | Somatostatin receptor type 4 |
Synonyms: | SOMATOSTATIN SST4 | SS-4-R | SS4-R | SS4R | SSR4_HUMAN | SST4R | SSTR4 | Somatostatin receptor type 4 (SSTR4) |
Type: | Enzyme |
Mol. Mass.: | 42015.38 |
Organism: | Homo sapiens (Human) |
Description: | P31391 |
Residue: | 388 |
Sequence: | MSAPSTLPPGGEEGLGTAWPSAANASSAPAEAEEAVAGPGDARAAGMVAIQCIYALVCLV
GLVGNALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASSAALRHWPFGSVLCR
AVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLP
IAIFADTRPARGGQAVACNLQWPHPAWSAVFVVYTFLLGFLLPVLAIGLCYLLIVGKMRA
VALRAGWQQRRRSEKKITRLVLMVVVVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILS
YANSCANPILYGFLSDNFRRFFQRVLCLRCCLLEGAGGAEEEPLDYYATALKSKGGAGCM
CPPLPCQQEALQPEPGRKRIPLTRTTTF
|
|
|
BDBM81766 |
---|
n/a |
---|
Name | BDBM81766 |
Synonyms: | CAS_3086456 | MK 678 | NSC_3086456 |
Type | Small organic molecule |
Emp. Form. | C44H56N8O7 |
Mol. Mass. | 808.9648 |
SMILES | CC(C)C1NC(=O)C(CCCCN)NC(=O)C(Cc2c[nH]c3ccccc23)NC(=O)C(Cc2ccc(O)cc2)NC(=O)C(C)N(C)C(=O)C(Cc2ccccc2)NC1=O |
Structure |
|