| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Somatostatin receptor type 5 |
|---|
| Ligand | BDBM50059090 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 137±n/a nM |
|---|
| Comments | PDSP_1405 |
|---|
| Citation |  Yang, L; Berk, SC; Rohrer, SP; Mosley, RT; Guo, L; Underwood, DJ; Arison, BH; Birzin, ET; Hayes, EC; Mitra, SW; Parmar, RM; Cheng, K; Wu, TJ; Butler, BS; Foor, F; Pasternak, A; Pan, Y; Silva, M; Freidinger, RM; Smith, RG; Chapman, K; Schaeffer, JM; Patchett, AA Synthesis and biological activities of potent peptidomimetics selective for somatostatin receptor subtype 2. Proc Natl Acad Sci U S A95:10836-41 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Somatostatin receptor type 5 |
|---|
| Name: | Somatostatin receptor type 5 |
|---|
| Synonyms: | SOMATOSTATIN SST5 | SS-5-R | SS5-R | SS5R | SSR5_HUMAN | SSTR5 | Somatostatin receptor type 5 (SSTR5) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39218.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P35346 |
|---|
| Residue: | 364 |
|---|
| Sequence: | MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTL
VIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDG
VNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADV
QEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRR
RSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCAN
PVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQ
TSKL
|
|
|
|---|
| BDBM50059090 |
|---|
| n/a |
|---|
| Name | BDBM50059090 |
|---|
| Synonyms: | 10-(4-Amino-butyl)-19-(2-amino-3-phenyl-propionylamino)-16-benzyl-7-(1-hydroxy-ethyl)-13-(1H-indol-3-ylmethyl)-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentaaza-cycloicosane-4-carboxylic acid (2-hydroxy-1-hydroxymethyl-propyl)-amide | CHEMBL405598 | SMS 201-995 | octreotide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C49H66N10O10S2 |
|---|
| Mol. Mass. | 1019.239 |
|---|
| SMILES | CC(O)[C@H](CO)NC(=O)[C@@H]1CSSCC(NC(=O)C(N)Cc2ccccc2)C(=O)N[C@H](Cc2ccccc2)C(=O)N[C@H](Cc2c[nH]c3ccccc23)C(=O)N[C@H](CCCCN)C(=O)N[C@H](C(C)O)C(=O)N1 |
|---|
| Structure | 
|
|---|
Search and Browse
