Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin V2 Receptor
LigandBDBM35714
Substrate/Competitorn/a
Ki 6.36±n/a nM
CommentsPDSP_1416
Citation Yamamura YNakamura SItoh SHirano TOnogawa TYamashita TYamada YTsujimae KAoyama MKotosai KOgawa HYamashita HKondo KTominaga MTsujimoto GMori T OPC-41061, a highly potent human vasopressin V2-receptor antagonist: pharmacological profile and aquaretic effect by single and multiple oral dosing in rats. J Pharmacol Exp Ther 287:860-7 (1998) [PubMed]
More Info.:Get all data from this article
 
Vasopressin V2 Receptor
Name:Vasopressin receptor
Synonyms:AVPR V2 | Antidiuretic hormone receptor | Renal-type arginine vasopressin receptor | VASOPRESSIN V2
Type:G-protein coupled receptor
Mol. Mass.:40761.85
Organism:Rattus norvegicus (Rat)
Description:n/a
Residue:371
Sequence:
MLLVSTVSAVPGLFSPPSSPSNSSQEELLDDRDPLLVRAELALLSTIFVAVALSNGLVLG
ALIRRGRRGRWAPMHVFISHLCLADLAVALFQVLPQLAWDATDRFHGPDALCRAVKYLQM
VGMYASSYMILAMTLDRHRAICRPMLAYRHGGGARWNRPVLVAWAFSLLLSLPQLFIFAQ
RDVGNGSGVFDCWARFAEPWGLRAYVTWIALMVFVAPALGIAACQVLIFREIHASLVPGP
SERAGRRRRGRRTGSPSEGAHVSAAMAKTVRMTLVIVIVYVLCWAPFFLVQLWAAWDPEA
PLERPPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCAQRHTTHSLGPQDESCAT
ASSSLMKDTPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35714
n/a
NameBDBM35714
Synonyms:CHEMBL420762 | Mozavaptan | N-[4-(5-Dimethylamino-2,3,4,5-tetrahydro-benzo[b]azepine-1-carbonyl)-phenyl]-2-methyl-benzamide | OPC-31260
TypeSmall organic molecule
Emp. Form.C27H29N3O2
Mol. Mass.427.5381
SMILESCN(C)C1CCCN(C(=O)c2ccc(NC(=O)c3ccccc3C)cc2)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: