| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Vasopressin V2 receptor |
|---|
| Ligand | BDBM35723 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 0.43±n/a nM |
|---|
| Comments | PDSP_1417 |
|---|
| Citation |  Yamamura, Y; Nakamura, S; Itoh, S; Hirano, T; Onogawa, T; Yamashita, T; Yamada, Y; Tsujimae, K; Aoyama, M; Kotosai, K; Ogawa, H; Yamashita, H; Kondo, K; Tominaga, M; Tsujimoto, G; Mori, T OPC-41061, a highly potent human vasopressin V2-receptor antagonist: pharmacological profile and aquaretic effect by single and multiple oral dosing in rats. J Pharmacol Exp Ther287:860-7 (1998) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Vasopressin V2 receptor |
|---|
| Name: | Vasopressin V2 receptor |
|---|
| Synonyms: | ADHR | AVPR V2 | AVPR2 | Antidiuretic hormone receptor | DIR | DIR3 | Renal-type arginine vasopressin receptor | V2R | V2R_HUMAN | VASOPRESSIN V2 | Vasopressin V2 receptor | Vasopressin receptor |
|---|
| Type: | Receptor |
|---|
| Mol. Mass.: | 40295.28 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30518 |
|---|
| Residue: | 371 |
|---|
| Sequence: | MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLA
ALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQM
VGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQ
RNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGP
SERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEA
PLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTT
ASSSLAKDTSS
|
|
|
|---|
| BDBM35723 |
|---|
| n/a |
|---|
| Name | BDBM35723 |
|---|
| Synonyms: | CHEMBL344159 | N-[4-(7-Chloro-5-hydroxy-2,3,4,5-tetrahydro-benzo[b]azepine-1-carbonyl)-3-methyl-phenyl]-2-methyl-benzamide | TOLVAPTAN | benzazepine derivative, 32 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H25ClN2O3 |
|---|
| Mol. Mass. | 448.941 |
|---|
| SMILES | Cc1ccccc1C(=O)Nc1ccc(C(=O)N2CCCC(O)c3cc(Cl)ccc23)c(C)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
