| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Alpha-2A adrenergic receptor |
|---|
| Ligand | BDBM50013515 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 6.3±n/a nM |
|---|
| Comments | PDSP_1987 |
|---|
| Citation |  Millan, MJ; Newman-Tancredi, A; Audinot, V; Cussac, D; Lejeune, F; Nicolas, JP; Cogé, F; Galizzi, JP; Boutin, JA; Rivet, JM; Dekeyne, A; Gobert, A Agonist and antagonist actions of yohimbine as compared to fluparoxan at alpha(2)-adrenergic receptors (AR)s, serotonin (5-HT)(1A), 5-HT(1B), 5-HT(1D) and dopamine D(2) and D(3) receptors. Significance for the modulation of frontocortical monoaminergic transmission and depressive states. Synapse35:79-95 (2000) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Alpha-2A adrenergic receptor |
|---|
| Name: | Alpha-2A adrenergic receptor |
|---|
| Synonyms: | ADA2A_HUMAN | ADRA2A | ADRA2R | ADRAR | Adrenergic alpha2A | Adrenergic receptor alpha | Alpha-2 adrenergic receptor subtype C10 | Alpha-2A adrenoceptor | Alpha-2A adrenoreceptor | Alpha-2AAR | alpha-2A adrenergic receptor [Homo sapiens] |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 48979.91 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P08913 |
|---|
| Residue: | 465 |
|---|
| Sequence: | MFRQEQPLAEGSFAPMGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLML
LTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAW
CEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVIS
FPPLISIEKKGGGGGPQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKR
RTRVPPSRRGPDAVAAPPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGP
RDTDALDLEESSSSDHAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTP
AAGPGEERVGAAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPR
TLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV
|
|
|
|---|
| BDBM50013515 |
|---|
| n/a |
|---|
| Name | BDBM50013515 |
|---|
| Synonyms: | (+)-yohimbine | (16alpha,17alpha)-17-hydroxyyohimban-16-carboxylic acid methyl ester | 17alpha-hydroxyyohimban-16alpha-carboxylic acid methyl ester | CHEMBL15245 | CORYNANTHINE | Johimbin | Quebrachin | RAUWOLSCINE | YOHIMBINE CHLORIDE | Yohimbin | Yohimbine | aphrodine | cid_8969 | corynine | methyl 17alpha-hydroxyyohimban-16alpha-carboxylate | quebrachine | yohimbic acid methyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H26N2O3 |
|---|
| Mol. Mass. | 354.4427 |
|---|
| SMILES | COC(=O)[C@H]1[C@@H](O)CC[C@H]2CN3CCc4c([nH]c5ccccc45)[C@@H]3C[C@H]12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
