| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 1B |
|---|
| Ligand | BDBM82071 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | >10000±n/a nM |
|---|
| Comments | PDSP_1947 |
|---|
| Citation |  Bymaster, FP; Dreshfield-Ahmad, LJ; Threlkeld, PG; Shaw, JL; Thompson, L; Nelson, DL; Hemrick-Luecke, SK; Wong, DT Comparative affinity of duloxetine and venlafaxine for serotonin and norepinephrine transporters in vitro and in vivo, human serotonin receptor subtypes, and other neuronal receptors. Neuropsychopharmacology25:871-80 (2001) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| 5-hydroxytryptamine receptor 1B |
|---|
| Name: | 5-hydroxytryptamine receptor 1B |
|---|
| Synonyms: | 5-HT-1B | 5-HT-1D-beta | 5-HT1B | 5-hydroxytryptamine receptor 1B (5-HT1B) | 5HT1B_HUMAN | HTR1B | HTR1DB | S12 | Serotonin (5-HT) receptor | Serotonin 1D beta receptor | Serotonin Receptor 1B |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 43579.17 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Receptor binding assays were performed using human clone stably expressed in CHO cells |
|---|
| Residue: | 390 |
|---|
| Sequence: | MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
|
|
|
|---|
| BDBM82071 |
|---|
| n/a |
|---|
| Name | BDBM82071 |
|---|
| Synonyms: | CAS_93413-69-5 | CAS_99300-78-4 | NSC_62923 | VENLAFAXINE | Venlafaxine hydrochloride | WY-45030 | WY-45655 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H27NO2 |
|---|
| Mol. Mass. | 277.4018 |
|---|
| SMILES | COc1ccc(cc1)C(CN(C)C)C1(O)CCCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
