Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPotassium Channel (Ca2+ dependent)
LigandBDBM82071
Substrate/Competitorn/a
Ki 1000±n/a nM
CommentsPDSP_1947
Citation Bymaster FPDreshfield-Ahmad LJThrelkeld PGShaw JLThompson LNelson DLHemrick-Luecke SKWong DT Comparative affinity of duloxetine and venlafaxine for serotonin and norepinephrine transporters in vitro and in vivo, human serotonin receptor subtypes, and other neuronal receptors. Neuropsychopharmacology 25:871-80 (2001) [PubMed]  Article
More Info.:Get all data from this article
 
Potassium Channel (Ca2+ dependent)
Name:Potassium Channel (Ca2+ dependent)
Synonyms:Calcium-activated potassium channel subunit beta-1
Type:Enzyme Catalytic Domain
Mol. Mass.:21917.35
Organism:RAT
Description:Potassium Channel (Ca2+ dependent) 0 RAT::P97678
Residue:191
Sequence:
MGKKLVMAQKRGETRALCLGVAMVVCAAITYYILGTTVLPLYQKSVWTQESTCHLVETNI
KDQEELEGRKVPQYPCLWVNVSAVGRWAMLYHTEDTRDQNQQCSYIPRNLDNYQTALVDV
KKVRANFYKHHNFYCFSAPQVNETSVVYQRLYGPQILLFSFFWPTFLLTGGLLIIAMVKL
NRSLSVLAAQK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82071
n/a
NameBDBM82071
Synonyms:CAS_93413-69-5 | CAS_99300-78-4 | NSC_62923 | VENLAFAXINE | Venlafaxine hydrochloride | WY-45030 | WY-45655
TypeSmall organic molecule
Emp. Form.C17H27NO2
Mol. Mass.277.4018
SMILESCOc1ccc(cc1)C(CN(C)C)C1(O)CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: