Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuromedin-K receptor
LigandBDBM50000041
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_574
Citation Anthes JCChapman RWRichard CEckel SCorboz MHey JAFernandez XGreenfeder SMcLeod RSehring SRizzo CCrawley YShih NYPiwinski JReichard GTing PCarruthers NCuss FMBillah MKreutner WEgan RW SCH 206272: a potent, orally active tachykinin NK(1), NK(2), and NK(3) receptor antagonist. Eur J Pharmacol 450:191-202 (2002) [PubMed]  Article
More Info.:Get all data from this article
 
Neuromedin-K receptor
Name:Neuromedin-K receptor
Synonyms:NK-3 receptor | NK-3R | NKR | Neurokinin 3 receptor | Neurokinin B receptor | Neurokinin-3 (NK-3) | Neuromedin-3 receptor (NK-3R) | Neuromedin-3 receptor (NK3) | Neuromedin-K receptor (NK3) | Tachykinin receptor 3 | Tachykinin receptor 3 (NK3)
Type:Enzyme
Mol. Mass.:52221.96
Organism:Homo sapiens (Human)
Description:P29371
Residue:465
Sequence:
MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGL
PVASPAPSQPWANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVT
NYFLVNLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIA
VDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEG
PKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKM
MIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLN
KRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADT
TRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50000041
n/a
NameBDBM50000041
Synonyms:(+) (2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (+)-(2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (+/-)(2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (-) (2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (-)-(2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (2-Methoxy-benzyl)-((1R,4S)-2-phenyl-piperidin-4-yl)-amine | (2-Methoxy-benzyl)-((2S,3S)-2-phenyl-piperidin-3-yl)-amine | (2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (2S,3S)-3-(2-Methoxy-benzyloxy)-2-phenyl-piperidine | (2S,3S)-N-(2-methoxybenzyl)-2-phenylpiperidin-3-amine | CHEMBL2114310 | CHEMBL441225 | CP 99994 | CP-99994 | Tritiated-(2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine
TypeSmall organic molecule
Emp. Form.C19H24N2O
Mol. Mass.296.4067
SMILESCOc1ccccc1CN[C@H]1CCCN[C@H]1c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: