| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Histamine receptor H3 |
|---|
| Ligand | BDBM86061 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 46.77±n/a nM |
|---|
| Comments | PDSP_2990 |
|---|
| Citation |  Esbenshade, TA; Krueger, KM; Miller, TR; Kang, CH; Denny, LI; Witte, DG; Yao, BB; Fox, GB; Faghih, R; Bennani, YL; Williams, M; Hancock, AA Two novel and selective nonimidazole histamine H3 receptor antagonists A-304121 and A-317920: I. In vitro pharmacological effects. J Pharmacol Exp Ther305:887-96 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Histamine receptor H3 |
|---|
| Name: | Histamine receptor H3 |
|---|
| Synonyms: | HISTAMINE H3 | HRH3 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 16901.59 |
|---|
| Organism: | Dog |
|---|
| Description: | Q865E3 |
|---|
| Residue: | 147 |
|---|
| Sequence: | FLLNLAISDFLVGAFCIPLYVPYVLTGRWPFSRGLCKLWLVVDYLLCTSSVFNIVLISYD
RFLSVTRAVSYRAQQGDTRRAVQKMVLVWVLAFLLYGPAILSWEHLSGGSSIPEGHCYAE
FFYNWYFLITASTLEFFTPFLSVTFFN
|
|
|
|---|
| BDBM86061 |
|---|
| n/a |
|---|
| Name | BDBM86061 |
|---|
| Synonyms: | A-304121 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C7H7N3O3 |
|---|
| Mol. Mass. | 181.1488 |
|---|
| SMILES | CCn1c2nocc2c(=O)[nH]c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
