Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetalpha-1 Nicotinic AChR
LigandBDBM50170601
Substrate/Competitorn/a
Ki 6000±n/a nM
CommentsPDSP_3056
Citation Cohen CBergis OEGalli FLochead AWJegham SBiton BLeonardon JAvenet PSgard FBesnard FGraham DCoste AOblin ACuret OVoltz CGardes ACaille DPerrault GGeorge PSoubrie PScatton B SSR591813, a novel selective and partial alpha4beta2 nicotinic receptor agonist with potential as an aid to smoking cessation. J Pharmacol Exp Ther 306:407-20 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
alpha-1 Nicotinic AChR
Name:Nicotinic acetylcholine receptor alpha-1/beta-1/delta/epsilon
Synonyms:Acetylcholine receptor protein alpha chain | Acetylcholine receptor subunit alpha | Cholinergic, Nicotinic Alpha1Beta1DeltaGamma | Cholinergic, Nicotinic Alpha1Beta2 | Nicotinic acetylcholine receptor alpha2/beta4 | n-AChR
Type:Ion channel
Mol. Mass.:54542.01
Organism:Homo sapiens (Human)
Description:n/a
Residue:482
Sequence:
MEPWPLLLLFSLCSAGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQL
INVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGV
KKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHF
PFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPD
TPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTV
FLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHHRSPSTHVMPNWVRKV
FIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSA
IEGIKYIAETMKSDQESNNAAAEWKYVAMVMDHILLGVFMLVCIIGTLAVFAGRLIELNQ
QG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50170601
n/a
NameBDBM50170601
Synonyms:(1R,10S)-9-oxa-4,13-diazatetracyclo[11.2.1.0^{1,10}.0^{3,8}]hexadeca-3,5,7-triene | CHEMBL187927 | SSR591813
TypeSmall organic molecule
Emp. Form.C13H16N2O
Mol. Mass.216.2789
SMILESC1C[C@@]23CN1CC[C@@H]2Oc1cccnc1C3
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: