Reaction Details |
| Report a problem with these data |
Target | Histamine receptor H3 |
---|
Ligand | BDBM27213 |
---|
Substrate/Competitor | n/a |
---|
Ki | 5.75±n/a nM |
---|
Comments | PDSP_2989 |
---|
Citation | Esbenshade, TA; Fox, GB; Krueger, KM; Miller, TR; Kang, CH; Denny, LI; Witte, DG; Yao, BB; Pan, L; Wetter, J; Marsh, K; Bennani, YL; Cowart, MD; Sullivan, JP; Hancock, AA Pharmacological properties of ABT-239 [4-(2-{2-[(2R)-2-Methylpyrrolidinyl]ethyl}-benzofuran-5-yl)benzonitrile]: I. Potent and selective histamine H3 receptor antagonist with drug-like properties. J Pharmacol Exp Ther313:165-75 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Histamine receptor H3 |
---|
Name: | Histamine receptor H3 |
Synonyms: | HISTAMINE H3 | HRH3 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 16901.59 |
Organism: | Dog |
Description: | Q865E3 |
Residue: | 147 |
Sequence: | FLLNLAISDFLVGAFCIPLYVPYVLTGRWPFSRGLCKLWLVVDYLLCTSSVFNIVLISYD
RFLSVTRAVSYRAQQGDTRRAVQKMVLVWVLAFLLYGPAILSWEHLSGGSSIPEGHCYAE
FFYNWYFLITASTLEFFTPFLSVTFFN
|
|
|
BDBM27213 |
---|
n/a |
---|
Name | BDBM27213 |
Synonyms: | 4-[3-(4-cyclopropanecarbonylphenoxy)propyl]-1H-imidazole | CHEMBL14638 | CHEMBL1795025 | Ciproxifan |
Type | Small organic molecule |
Emp. Form. | C16H18N2O2 |
Mol. Mass. | 270.3263 |
SMILES | O=C(C1CC1)c1ccc(OCCCc2cnc[nH]2)cc1 |
Structure |
|