Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM86694 |
---|
Substrate/Competitor | n/a |
---|
Ki | >10000±n/a nM |
---|
Comments | PDSP_4918 |
---|
Citation | Miyata, N; Seki, T; Tanaka, Y; Omura, T; Taniguchi, K; Doi, M; Bandou, K; Kametani, S; Sato, M; Okuyama, S; Cambj-Sapunar, L; Harder, DR; Roman, RJ Beneficial effects of a new 20-hydroxyeicosatetraenoic acid synthesis inhibitor, TS-011 [N-(3-chloro-4-morpholin-4-yl) phenyl-N'-hydroxyimido formamide], on hemorrhagic and ischemic stroke. J Pharmacol Exp Ther314:77-85 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM86694 |
---|
n/a |
---|
Name | BDBM86694 |
Synonyms: | N'-(3-Chloro-4-morpholinophenyl)-N-hydroxyformamidine | TS-011 |
Type | Small organic molecule |
Emp. Form. | C11H14ClN3O2 |
Mol. Mass. | 255.701 |
SMILES | ONC=Nc1ccc(N2CCOCC2)c(Cl)c1 |w:3.3| |
Structure |
|