| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Macrophage migration inhibitory factor |
|---|
| Ligand | BDBM92409 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Tautomerase Activity Assay |
|---|
| IC50 | 9.5e+3± 1.7e+3 nM |
|---|
| Citation |  Alam, A; Haldar, S; Thulasiram, HV; Kumar, R; Goyal, M; Iqbal, MS; Pal, C; Dey, S; Bindu, S; Sarkar, S; Pal, U; Maiti, NC; Bandyopadhyay, U Novel Anti-inflammatory Activity of Epoxyazadiradione against Macrophage Migration Inhibitory Factor: INHIBITION OF TAUTOMERASE AND PROINFLAMMATORY ACTIVITIES OF MACROPHAGE MIGRATION INHIBITORY FACTOR. J Biol Chem287:24844-61 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Macrophage migration inhibitory factor |
|---|
| Name: | Macrophage migration inhibitory factor |
|---|
| Synonyms: | Macrophage migration inhibitory factor (MIF) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 12844.38 |
|---|
| Organism: | Plasmodium falciparum |
|---|
| Description: | Q6Q3H7 |
|---|
| Residue: | 116 |
|---|
| Sequence: | MPCCEVITNVNLPDDNVQSTLSQIENAISDVMGKPLGYIMSNYDYQKNLRFGGSNEAYCF
VRITSIGGINRSNNSALADQITKLLVSNLNVKSRRIYVEFRDCSAQNFAFSGSLFG
|
|
|
|---|
| BDBM92409 |
|---|
| n/a |
|---|
| Name | BDBM92409 |
|---|
| Synonyms: | Epoxyazadiradione |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H34O6 |
|---|
| Mol. Mass. | 466.566 |
|---|
| SMILES | CC(=O)O[C@@H]1C[C@H]2C(C)(C)C(=O)C=C[C@]2(C)[C@H]2CC[C@@]3(C)[C@@H](C(=O)[C@H]4O[C@@]34[C@]12C)c1ccoc1 |c:12| |
|---|
| Structure | 
|
|---|
Search and Browse
