Reaction Details |
| Report a problem with these data |
Target | Ubiquitin-like modifier-activating enzyme 1 [957-994] |
---|
Ligand | BDBM92475 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Ubiquitin Thioester Inhibtion Assay |
---|
IC50 | 5.21E3±0 nM |
---|
Citation | Chen, JJ; Tsu, CA; Gavin, JM; Milhollen, MA; Bruzzese, FJ; Mallender, WD; Sintchak, MD; Bump, NJ; Yang, X; Ma, J; Loke, HK; Xu, Q; Li, P; Bence, NF; Brownell, JE; Dick, LR Mechanistic studies of substrate-assisted inhibition of ubiquitin-activating enzyme by adenosine sulfamate analogues. J Biol Chem286:40867-77 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Ubiquitin-like modifier-activating enzyme 1 [957-994] |
---|
Name: | Ubiquitin-like modifier-activating enzyme 1 [957-994] |
Synonyms: | A1S9T | UBA1 | UBA1_HUMAN | UBE1 | Ubiquitin activating enzyme (UAE) |
Type: | Enzyme |
Mol. Mass.: | 4484.57 |
Organism: | Homo sapiens (Human) |
Description: | Q712V1 |
Residue: | 38 |
Sequence: | RFEVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGV
|
|
|
BDBM92475 |
---|
n/a |
---|
Name | BDBM92475 |
Synonyms: | Compound I |
Type | Small organic molecule |
Emp. Form. | C19H22N6O6S |
Mol. Mass. | 462.48 |
SMILES | NS(=O)(=O)OC[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(NC3CCc4ccccc34)ncnc12 |r| |
Structure |
|