Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 142 (CYP142)
LigandBDBM92505
Substrate/Competitorn/a
Meas. Tech.Binding Assay
Kd 3.6e+2± 4e+1 nM
Citation Driscoll MDMcLean KJLevy CMast NPikuleva IALafite PRigby SELeys DMunro AW Structural and biochemical characterization of Mycobacterium tuberculosis CYP142: evidence for multiple cholesterol 27-hydroxylase activities in a human pathogen. J Biol Chem 285:38270-82 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 142 (CYP142)
Name:Cytochrome P450 142 (CYP142)
Synonyms:Cytochrome P450 142
Type:Enzyme
Mol. Mass.:41422.72
Organism:Mycobacterium tuberculosis
Description:P9WPL4
Residue:372
Sequence:
MRANQPVFRDRNGLAAASTYQAVIDAERQPELFSNAGGIRPDQPALPMMIDMDDPAHLLR
RKLVNAGFTRKRVKDKEASIAALCDTLIDAVCERGECDFVRDLAAPLPMAVIGDMLGVRP
EQRDMFLRWSDDLVTFLSSHVSQEDFQITMDAFAAYNDFTRATIAARRADPTDDLVSVLV
SSEVDGERLSDDELVMETLLILIGGDETTRHTLSGGTEQLLRNRDQWDLLQRDPSLLPGA
IEEMLRWTAPVKNMCRVLTADTEFHGTALCAGEKMMLLFESANFDEAVFCEPEKFDVQRN
PNSHLAFGFGTHFCLGNQLARLELSLMTERVLRRLPDLRLVADDSVLPLRPANFVSGLES
MPVVFTPSPPLG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM92505
n/a
NameBDBM92505
Synonyms:4-Cholesten-3-one | Steroid scaffold, 14
TypeOrganic molecule
Emp. Form.C27H44O
Mol. Mass.384.6377
SMILESCC(C)CCC[C@@H](C)[C@H]1CC[C@H]2[C@@H]3CCC4=CC(=O)CC[C@]4(C)[C@H]3CC[C@]12C |t:15|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: