| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Stromal cell-derived factor 1 |
|---|
| Ligand | BDBM29143 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Tryptophan Fluorescence Assay |
|---|
| Temperature | 293.15±0 K |
|---|
| IC50 | >5.00e+5±n/a nM |
|---|
| Citation |  Hachet-Haas, M; Balabanian, K; Rohmer, F; Pons, F; Franchet, C; Lecat, S; Chow, KY; Dagher, R; Gizzi, P; Didier, B; Lagane, B; Kellenberger, E; Bonnet, D; Baleux, F; Haiech, J; Parmentier, M; Frossard, N; Arenzana-Seisdedos, F; Hibert, M; Galzi, JL Small neutralizing molecules to inhibit actions of the chemokine CXCL12. J Biol Chem283:23189-99 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Stromal cell-derived factor 1 |
|---|
| Name: | Stromal cell-derived factor 1 |
|---|
| Synonyms: | CXCL12 | Chemokine CXCL12 | SDF1 | SDF1A | SDF1B | SDF1_HUMAN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10677.83 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P48061 |
|---|
| Residue: | 93 |
|---|
| Sequence: | MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
|
|
|
|---|
| BDBM29143 |
|---|
| n/a |
|---|
| Name | BDBM29143 |
|---|
| Synonyms: | CHEMBL7976 | Chalcone 1 | Chalcone, 13 | cid_637760 | substituted chalcone, 5j |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H12O |
|---|
| Mol. Mass. | 208.2552 |
|---|
| SMILES | O=C(\C=C\c1ccccc1)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
