Reaction Details |
| Report a problem with these data |
Target | Ribosyldihydronicotinamide dehydrogenase [quinone] |
---|
Ligand | BDBM92772 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Cell Assay |
---|
IC50 | >1.0e+4±n/a nM |
---|
Citation | Yan, C; Dufour, M; Siegel, D; Reigan, P; Gomez, J; Shieh, B; Moody, CJ; Ross, D Indolequinone inhibitors of NRH:quinone oxidoreductase 2. Characterization of the mechanism of inhibition in both cell-free and cellular systems. Biochemistry50:6678-88 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Ribosyldihydronicotinamide dehydrogenase [quinone] |
---|
Name: | Ribosyldihydronicotinamide dehydrogenase [quinone] |
Synonyms: | Metallothionein-3 | NMOR2 | NQO2 | NQO2_HUMAN | NRH dehydrogenase [quinone] 2 | NRH:quinone oxidoreductase 2 | QR2 | Quinone reductase 2 | Quinone reductase 2 (NQO2) | Ribosyldihydronicotinamide dehydrogenase [quinone] |
Type: | Protein |
Mol. Mass.: | 25917.25 |
Organism: | Homo sapiens (Human) |
Description: | P16083 |
Residue: | 231 |
Sequence: | MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTL
SNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRV
LCQGFAFDIPGFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFC
GFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ
|
|
|
BDBM92772 |
---|
n/a |
---|
Name | BDBM92772 |
Synonyms: | Indolequinone, compd 6 |
Type | Small molecule |
Emp. Form. | C22H24F3N3O3 |
Mol. Mass. | 435.4395 |
SMILES | CN(C)CCC=Nc1cc(O)c2c(COc3c(F)cc(F)cc3F)c(C)n(C)c2c1O |w:6.6| |
Structure |
|