Reaction Details |
| Report a problem with these data |
Target | Proto-oncogene tyrosine-protein kinase Src |
---|
Ligand | BDBM4069 |
---|
Substrate/Competitor | Poly(E:Y) |
---|
Meas. Tech. | Kinase Inhibition Assay |
---|
IC50 | >50000±n/a nM |
---|
Citation | Boschelli, DH; Wu, Z; Klutchko, SR; Showalter, HD; Hamby, JM; Lu, GH; Major, TC; Dahring, TK; Batley, B; Panek, RL; Keiser, J; Hartl, BG; Kraker, AJ; Klohs, WD; Roberts, BJ; Patmore, S; Elliott, WL; Steinkampf, R; Bradford, LA; Hallak, H; Doherty, AM Synthesis and tyrosine kinase inhibitory activity of a series of 2-amino-8H-pyrido[2,3-d]pyrimidines: identification of potent, selective platelet-derived growth factor receptor tyrosine kinase inhibitors. J Med Chem41:4365-77 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Proto-oncogene tyrosine-protein kinase Src |
---|
Name: | Proto-oncogene tyrosine-protein kinase Src |
Synonyms: | Calmodulin/Proto-oncogene tyrosine-protein kinase Src | Protein cereblon/Tyrosine-protein kinase SRC | Proto-oncogene c-Src | Proto-oncogene tyrosine-protein kinase Src (c-Src) | SRC | SRC1 | SRC_HUMAN | Tyrosine-protein kinase Src (SRC) | V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) | c-Src | p60-Src | pp60c-src |
Type: | Protein |
Mol. Mass.: | 59838.60 |
Organism: | Homo sapiens (Human) |
Description: | P12931 |
Residue: | 536 |
Sequence: | MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
|
|
|
BDBM4069 |
---|
Poly(E:Y) |
---|
Name: | Poly(E:Y) |
Synonyms: | n/a |
Type: | Random polymer |
Mol. Mass.: | 358.43 |
Organism: | n/a |
Description: | Random copolymer of glutamic acid and tyrosine (4:1). 50 uM ATP containing 0.4 uCi of [gamma-32P]ATP as co-substrate |
Residue: | 3 |
Sequence: | |