Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetJumonji domain-containing protein 2C (JMJD2C)
LigandBDBM103844
Substrate/Competitorn/a
Meas. Tech.In vitro Hydroxylation Assays for PHD2 (AlphaScreen)
pH7.5±0
IC50>1.00e+5± 0 nM
Citation Chowdhury RCandela-Lena JIChan MCGreenald DJYeoh KKTian YMMcDonough MATumber ARose NRConejo-Garcia ADemetriades MMathavan SKawamura ALee MKvan Eeden FPugh CWRatcliffe PJSchofield CJ Selective Small Molecule Probes for the Hypoxia Inducible Factor (HIF) Prolyl Hydroxylases. ACS Chem Biol 8:1488-96 (2013) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Jumonji domain-containing protein 2C (JMJD2C)
Name:Jumonji domain-containing protein 2C (JMJD2C)
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:110027.72
Organism:Homo sapiens (Human)
Description:n/a
Residue:973
Sequence:
MEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQC
YDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKYCTPRYLDYEDLE
RKYWKNLTFVAPIYGADINGSIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYF
GMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFL
RHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATVRWID
YGKVAKLCTCRKDMVKISMDIFVRKFQPDRYQLWKQGKDIYTIDHTKPTPASTPEVKAWL
QRRRKVRKASRSFQCARSTSKRPKADEEEEVSDEVDGAEVPNPDSVTDDLKVSEKSEAAV
KLRNTEASSEEESSASRMQVEQNLSDHIKLSGNSCLSTSVTEDIKTEDDKAYAYRSVPSI
SSEADDSIPLSSGYEKPEKSDPSELSWPKSPESCSSVAESNGVLTEGEESDVESHGNGLE
PGEIPAVPSGERNSFKVPSIAEGENKTSKSWRHPLSRPPARSPMTLVKQQAPSDEELPEV
LSIEEEVEETESWAKPLIHLWQTKSPNFAAEQEYNATVARMKPHCAICTLLMPYHKPDSS
NEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEYSPPNAFLEEDGTSLLISCAK
CCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAV
AVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYGRCPASFHVTC
AHAAGVLMEPDDWPYVVNITCFRHKVNPNVKSKACEKVISVGQTVITKHRNTRYYSCRVM
AVTSQTFYEVMFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLYGAKYFGS
NIAHMYQVEFEDG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM103844
n/a
NameBDBM103844
Synonyms:4HQ derivative 7
TypeSmall organic molecule
Emp. Form.C15H14N2O4
Mol. Mass.286.2827
SMILESOC(=O)CNC(=O)c1nc(CC=C)c2ccccc2c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: