Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 protease M4
LigandBDBM104101
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
Ki 1.920±0.834 nM
Citation Shen YAltman MDAli ANalam MNCao HRana TMSchiffer CATidor B Testing the substrate-envelope hypothesis with designed pairs of compounds. ACS Chem Biol 8:2433-41 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
HIV-1 protease M4
Name:HIV-1 protease M4
Synonyms:HIV-1 protease drug-resistant mutant 4
Type:Protein
Mol. Mass.:10771.71
Organism:Human immunodeficiency virus
Description:n/a
Residue:99
Sequence:
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGVGGFIKVKQYE
QVLIEICGKKVIGTVLVGPTPVNIIGRNMLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM104101
n/a
NameBDBM104101
Synonyms:MIT-2-AD-93 (AD-93)
TypeSmall organic molecule
Emp. Form.C29H33N3O5S2
Mol. Mass.567.719
SMILESCC[C@H](C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)c1cccc(O)c1)S(=O)(=O)c1ccc2ncsc2c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: