| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Apoptosis regulator Bcl-2 |
|---|
| Ligand | BDBM109236 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | SPR Directy Binding Assay (Biacore 4000) |
|---|
| pH | 7.4±n/a |
|---|
| IC50 | >12000±0 nM |
|---|
| Kd | >750±0.0 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Lessene, G; Czabotar, PE; Sleebs, BE; Zobel, K; Lowes, KN; Adams, JM; Baell, JB; Colman, PM; Deshayes, K; Fairbrother, WJ; Flygare, JA; Gibbons, P; Kersten, WJ; Kulasegaram, S; Moss, RM; Parisot, JP; Smith, BJ; Street, IP; Yang, H; Huang, DC; Watson, KG Structure-guided design of a selective BCL-X(L) inhibitor. Nat Chem Biol9:390-7 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Apoptosis regulator Bcl-2 |
|---|
| Name: | Apoptosis regulator Bcl-2 |
|---|
| Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
|---|
| Type: | Homodimer or heterodimer |
|---|
| Mol. Mass.: | 26269.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10415 |
|---|
| Residue: | 239 |
|---|
| Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
|---|
| BDBM109236 |
|---|
| n/a |
|---|
| Name | BDBM109236 |
|---|
| Synonyms: | WEHI-539 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H29N5O3S2 |
|---|
| Mol. Mass. | 583.724 |
|---|
| SMILES | NCc1ccc(OCCCc2sc(nc2C(O)=O)-c2ccc3CCCC(=NNc4nc5ccccc5s4)c3c2)cc1 |w:26.27| |
|---|
| Structure | 
|
|---|
Search and Browse
