Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAmine oxidase [flavin-containing] A
LigandBDBM50105417
Substrate/Competitorn/a
Meas. Tech.MAO-A/B Activity and Inhibition Assay
pH7.5±n/a
Ki 8.2e+2± 4.7e+2 nM
Commentsextracted
Citation Prusevich PKalin JHMing SABasso MGivens JLi XHu JTaylor MSCieniewicz AMHsiao PYHuang RRoberson HAdejola NAvery LBCasero RATaverna SDQian JTackett AJRatan RRMcDonald OGFeinberg APCole PA A Selective Phenelzine Analogue Inhibitor of Histone Demethylase LSD1. ACS Chem Biol 9:1284-93 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Amine oxidase [flavin-containing] A
Name:Monoamine oxidase
Synonyms:Amine oxidase (flavin-containing) A | MAO-A | Monoamine oxidase | Monoamine oxidase type A | Monoamine oxidase type A (MAO A) | Monoamine oxidase type A (MAO A) | Monoamine oxidase type A (MAOA)
Type:Protein
Mol. Mass.:59689.53
Organism:Homo sapiens (Human)
Description:P21397
Residue:527
Sequence:
MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV
DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL
NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR
LAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD
VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50105417
n/a
NameBDBM50105417
Synonyms:CHEMBL1089 | Nardil | PHENELZINE | Phenethyl-hydrazine
TypeSmall organic molecule
Emp. Form.C8H12N2
Mol. Mass.136.1943
SMILESNNCCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: