Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase ILK-1
LigandBDBM124033
Substrate/Competitorn/a
Meas. Tech.In Vitro Ezyme Assay
Temperature313.15±n/a K
IC50 60±n/a nM
Commentsextracted
Citation Zhang ZDaynard TSWang SDu XChopiuk GBYan JChen JSviridov SV Pyrazolylbenzothiazole derivatives and their use as therapeutic agents US Patent  US8754233 Publication Date 6/17/2014
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase ILK-1
Name:Serine/threonine-protein kinase ILK-1
Synonyms:Integrin-linked protein kinase (ILK) | Serine/threonine-protein kinase ILK-1
Type:Protein
Mol. Mass.:51429.75
Organism:Homo sapiens (Human)
Description:Q13418
Residue:452
Sequence:
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM124033
n/a
NameBDBM124033
Synonyms:US8754233, 4-Benzothiazol-2-yl-5-piperidin-4-yl-2H-pyrazol-3-ylamine
TypeSmall organic molecule
Emp. Form.C15H17N5S
Mol. Mass.299.394
SMILESNc1n[nH]c(C2CCNCC2)c1-c1nc2ccccc2s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: