| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50429700 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| IC50 | 29±n/a nM |
|---|
| Citation |  Anderson, AC; Wright, DL; Frey, KM; Paulsen, JL; Scocchera, EW; Viswanathan, K Heterocyclic analogs of propargyl-linked inhibitors of dihydrofolate reductase US Patent US8853228 Publication Date 10/7/2014 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_STAAU | Dihydrofolate Reductase (DHFR) | Dihydrofolate reductase | Dihydrofolate reductase (DfrB) | Tetrahydrofolate dehydrogenase | folA |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18249.71 |
|---|
| Organism: | Staphylococcus aureus |
|---|
| Description: | n/a |
|---|
| Residue: | 159 |
|---|
| Sequence: | MTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRN
VVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRG
DTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
|
|
|
|---|
| BDBM50429700 |
|---|
| n/a |
|---|
| Name | BDBM50429700 |
|---|
| Synonyms: | CHEMBL2335416 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H25N5O2 |
|---|
| Mol. Mass. | 367.4448 |
|---|
| SMILES | COc1cc(cc(c1)N1CCOCC1)C(C)C#Cc1c(C)nc(N)nc1N |
|---|
| Structure | 
|
|---|
Search and Browse
