Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM150165 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Competitive Binding Assay |
---|
Temperature | 303.15±n/a K |
---|
Ki | 49.19±n/a nM |
---|
IC50 | 115.6±n/a nM |
---|
Comments | extracted |
---|
Citation | Yang, R; Li, Y; Li, Y; Zhao, N; Yun, L; Qin, J; Feng, Z; Zhang, Y 2-aryl imidazo[1,2-a]pyridine-3-acetamide derivatives, preparation methods and uses thereof US Patent US8980887 Publication Date 3/17/2015 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM150165 |
---|
n/a |
---|
Name | BDBM150165 |
Synonyms: | US8980887, Compound 7 |
Type | Small organic molecule |
Emp. Form. | C25H23Cl2N3O |
Mol. Mass. | 452.376 |
SMILES | CCN(Cc1ccccc1)C(=O)Cc1c(nc2cc(C)ccn12)-c1ccc(Cl)c(Cl)c1 |
Structure |
|