| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Thiamine transporter ThiT |
|---|
| Ligand | BDBM50373886 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Intrinsic-Fluorescence Titration |
|---|
| Kd | 4.23±1.69 nM |
|---|
| Citation |  Swier, LJ; Monjas, L; Guskov, A; de Voogd, AR; Erkens, GB; Slotboom, DJ; Hirsch, AK Structure-based design of potent small-molecule binders to the S-component of the ECF transporter for thiamine. Chembiochem16:819-26 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Thiamine transporter ThiT |
|---|
| Name: | Thiamine transporter ThiT |
|---|
| Synonyms: | THIT_LACLM | Thiamine transporter (ThiT) | thiT |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 19919.46 |
|---|
| Organism: | Lactococcus lactis (Firmicutes) |
|---|
| Description: | 3RLB |
|---|
| Residue: | 182 |
|---|
| Sequence: | MSNSKFNVRLLTEIAFMAALAFIISLIPNTVYGWIIVEIACIPILLLSLRRGLTAGLVGG
LIWGILSMITGHAYILSLSQAFLEYLVAPVSLGIAGLFRQKTAPLKLAPVLLGTFVAVLL
KYFFHFIAGIIFWSQYAWKGWGAVAYSLAVNGISGILTAIAAFVILIIFVKKFPKLFIHS
NY
|
|
|
|---|
| BDBM50373886 |
|---|
| n/a |
|---|
| Name | BDBM50373886 |
|---|
| Synonyms: | 3-Deazathiamine | CHEMBL401772 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H17N3OS |
|---|
| Mol. Mass. | 263.359 |
|---|
| SMILES | Cc1c(Cc2cnc(C)nc2N)csc1CCO |
|---|
| Structure | 
|
|---|
Search and Browse
